Protein Info for QEN71_RS15350 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome o ubiquinol oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details TIGR02842: cytochrome o ubiquinol oxidase, subunit III" amino acids 23 to 202 (180 residues), 276.3 bits, see alignment E=7.7e-87 PF00510: COX3" amino acids 24 to 198 (175 residues), 52 bits, see alignment E=4.8e-18

Best Hits

Swiss-Prot: 37% identical to QOX3_STAAM: Probable quinol oxidase subunit 3 (qoxC) from Staphylococcus aureus (strain Mu50 / ATCC 700699)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 94% identity to bph:Bphy_3970)

MetaCyc: 36% identical to menaquinol oxidase subunit III (Staphylococcus epidermidis RP62A)
RXN-12164 [EC: 7.1.1.5]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>QEN71_RS15350 cytochrome o ubiquinol oxidase subunit III (Paraburkholderia sabiae LMG 24235)
MLQKAIVADPHHHDAEHAPSNSVFGFWLYLMTDCILFAALFATFAVMSHQFAGGPSGKDL
FEIPGVALETAILLFSSITYGFAMLGAHKNNKSTTLLWLAVTFVLGAAFVVLEIREFSHL
IADGAGPDRSAFLSAFFTLVGTHGLHVTSGLVWMLVMMIQVIRAPKLGERELRRLTCLSL
FWHFLDIVWIGVFSFVYLASVI