Protein Info for QEN71_RS15145 in Paraburkholderia sabiae LMG 24235

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 812 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07660: STN" amino acids 68 to 115 (48 residues), 34.4 bits, see alignment 2.3e-12 PF07715: Plug" amino acids 159 to 257 (99 residues), 64.2 bits, see alignment E=2.3e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 161 to 812 (652 residues), 336.6 bits, see alignment E=1.7e-104 PF00593: TonB_dep_Rec" amino acids 332 to 781 (450 residues), 220.3 bits, see alignment E=1.4e-68

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 69% identity to rme:Rmet_3999)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (812 amino acids)

>QEN71_RS15145 TonB-dependent receptor (Paraburkholderia sabiae LMG 24235)
MGFSTGTRNRHVIGLAAAAIFASAASPAVRAADATQTTQSITRKTFDVAAGPLESALNQF
GQQARIMLSYPSALTANRHSAGLRGEYDTQQGLTQLLRGTGVSAVEQTNGSYTLVEDASN
VELDDSTVLPVMKVSSTGISAGSYRPPPEANVTRSDIPVIDTPQAINVVPAQVLHDQRPR
NLDDALANVSGIVQGNTLAGTQDTLLKRGFGGNRDGSIMHNGMPLVQGRGLNAAADSVEV
LKGPASLLYGIMDPGGVVNVVSKQPLLTPYHAVSVLGSTYGHGRNGGGGTVDLTGPIGDS
GLAYRLIVDHTNEQYWRNFGEHRETLVAPSLAWYGRDTQIVLSYEYRKFLYPFDRGTALD
PKTNEPLAIPARERLDEPFNEMDGESHLAQLTVDHQINADWKAHFGYSYNRETYDAGQLR
VQGVNSTTGVLSRSNDATHGALSTDSYAIAYVDGHFNVAGLRNDLQIGVDDEYRRIYRKD
LLRQATKYTFNYLHPVYGLESPSTTVSASDSDQTDTLHDSSLFLQDSLHLTDKWILVGGA
RFMSYNQVAGRGRPFQINTDLNGTKWLPRAGIVYKWTENFSLYGSYTQSLKPTSTIAPLS
SGVVINSSVLPEEATSWEVGAKVAMPAGLTGTLALFNIDKSNVLVSQYNDTTKQTDWRTS
GKARSRGVELDVAGQIGQHWSVIASYAYIDAKTTEDPLYAGNRLWNVAQHTASLAAVYDF
GAIFGGDQLRVGAGAHYVGERPGDSANSFTLPAYTVADAFATYNTKWGGRNLSFQLNVKN
LFNKTYYPSSANRYFVAVGDARQVSLLSTLEF