Protein Info for QEN71_RS14835 in Paraburkholderia sabiae LMG 24235

Annotation: protocatechuate 3,4-dioxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02423: protocatechuate 3,4-dioxygenase, alpha subunit
  • amino acids 7 to 196 (190 residues), 234 bits, E=6.6e-74
• PF00775: Dioxygenase_C
  • amino acids 40 to 118 (79 residues), 31.8 bits, E=4.9e-12

Best Hits

Swiss-Prot: 73% identical to PCXA_BURCE: Protocatechuate 3,4-dioxygenase alpha chain (pcaG) from Burkholderia cepacia

KEGG orthology group: K00448, protocatechuate 3,4-dioxygenase, alpha subunit [EC: 1.13.11.3] (inferred from 95% identity to bph:Bphy_3890)

MetaCyc: 44% identical to protocatechuate 3,4-dioxygenase alpha subunit (Pseudomonas putida)
Protocatechuate 3,4-dioxygenase. [EC: 1.13.11.3]; 1.13.11.- [EC: 1.13.11.3]

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• gallate degradation II (4/5 steps found)
• 4-sulfocatechol degradation (3/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Protein Sequence (196 amino acids)

>QEN71_RS14835 protocatechuate 3,4-dioxygenase subunit alpha (Paraburkholderia sabiae LMG 24235)
MTTLKQTPSQTVGPYFAYGLCPQQYNFDLKSLFTGVVADREAAGEHITVVGQVFDGDGAI
IGDAMIEVQQVDSEGRYPASREEVAKTGFRGFARFGTGTDPQKRFIIETVKPGRASPDEA
PHLNVIVTMRGMLLHTFTRVYFDDEAAANDKDPVLASVPAERRATLVAKRESNAGNAVYR
FDIRMQGPNETVFFDL