Protein Info for QEN71_RS14760 in Paraburkholderia sabiae LMG 24235

Annotation: CDP-alcohol phosphatidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 45 to 74 (30 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 178 to 207 (30 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 35 to 155 (121 residues), 45.3 bits, see alignment E=6.5e-16

Best Hits

KEGG orthology group: None (inferred from 89% identity to bph:Bphy_3874)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>QEN71_RS14760 CDP-alcohol phosphatidyltransferase family protein (Paraburkholderia sabiae LMG 24235)
MTSQSHPPRNVPPARMWDARLARRLIMPLVDTPVTPNHLTTLRLLIGLAGGVALARGGFA
WTNIGALLIVLSNFVDHTDGELARVSGKSSRIGHFYDLASDALVTVLLFGGMGYGMTSAQ
VSSLIGVHASPFLLGTIAGIAVALIFFLRMRIEEMAGKAGTKQASVGGFETEDVLYLLPL
VTLTGGVAPFLVAASIGAPLFAAYVVIDYRRVVRRTRPAQETSQAVASQ