Protein Info for QEN71_RS14230 in Paraburkholderia sabiae LMG 24235

Annotation: alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02318: phosphonate metabolism protein PhnM
  • amino acids 3 to 376 (374 residues), 465.7 bits, E=5.1e-144

Best Hits

KEGG orthology group: K06162, PhnM protein (inferred from 95% identity to bph:Bphy_3779)

MetaCyc: 48% identical to alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (Sinorhizobium meliloti 1021)
RXN-17958 [EC: 3.6.1.63]

Predicted SEED Role

"Metal-dependent hydrolase involved in phosphonate metabolism" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• methylphosphonate degradation I (3/5 steps found)
• (aminomethyl)phosphonate degradation (5/8 steps found)
• glyphosate degradation III (4/7 steps found)
• methylphosphonate degradation II (2/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.63

Protein Sequence (377 amino acids)

>QEN71_RS14230 alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (Paraburkholderia sabiae LMG 24235)
MLIKNARVVTRDEVFNGVVQIEDGVIREVARGTTSAADAQDWEGDYLLPGLIELHTDNLE
KHLLPRPGVEWNTDAAFVIHDAQVAAAGITTVFDALAIGSRSSVGLRGRDTQTRCAAALQ
RFSERKLLRAEHFLHLRCEIATSDVVEVFDTLKDHPLLRLASVMDHTPGQRQWHDREQWR
RFQERHGKMTDEHMAATLVALEDEQQRFADEHRRQIVERCKALGVPVASHDDTLVEHVQQ
AAEEGIVLAEFPTTRVAAEAAHRHGIATIMGAPNIVRGGSHSGNVSALELAQANLLDILS
SDYVPSSLLTAAFELVDKAGWTLPRAMATVSAEPARTAGLHDRGAIEPGLRADLVRVTML
DALPVPRATYRAGERIV