Protein Info for QEN71_RS14220 in Paraburkholderia sabiae LMG 24235

Annotation: phosphonate C-P lyase system protein PhnK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR02323: phosphonate C-P lyase system protein PhnK" amino acids 3 to 254 (252 residues), 375.9 bits, see alignment E=4.1e-117 PF00005: ABC_tran" amino acids 21 to 178 (158 residues), 105.2 bits, see alignment E=4.6e-34

Best Hits

Swiss-Prot: 66% identical to PHNK_ECOLI: Putative phosphonates utilization ATP-binding protein PhnK (phnK) from Escherichia coli (strain K12)

KEGG orthology group: K05781, putative phosphonate transport system ATP-binding protein (inferred from 97% identity to bph:Bphy_3777)

MetaCyc: 66% identical to ATP-binding cassette protein PhnK (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphonates transport ATP-binding protein PhnK" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>QEN71_RS14220 phosphonate C-P lyase system protein PhnK (Paraburkholderia sabiae LMG 24235)
MTPLLSARALTKQYGGRNGCRNVSFDLYPGEVLCIVGESGSGKSTLLNALALRTPADSGS
LHYASAHGDALDLLALSEPRKRLLMRTEWGFVQQNPRDGLRSSVSAGANIGEPLMAVGAR
HYGNIREAATQWMSRVELDASRIDELPSAFSGGMQQRLQIARNLVTGPRLVFMDEPTAGL
DVSVQARLLDLLRTLTSTLHLSVLIVTHDIGVARLLAHRLMVMQGGEVVEAGLTDQVLDD
PQHPYTQTLVSSVLPV