Protein Info for QEN71_RS14025 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00970: FAD_binding_6" amino acids 20 to 122 (103 residues), 39.9 bits, see alignment E=6.6e-14 PF00175: NAD_binding_1" amino acids 134 to 240 (107 residues), 59.3 bits, see alignment E=8.4e-20 PF00111: Fer2" amino acids 304 to 361 (58 residues), 38.5 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 50% identity to mci:Mesci_2598)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.17

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>QEN71_RS14025 FAD-binding oxidoreductase (Paraburkholderia sabiae LMG 24235)
MNAVAEQAERSAASGFRRFRVNGRQQESASIVSFELVPADGAAPLPFIAGQFVTLRLPIS
SGERLLRTYSLSGDPADATRWRISVKRESARDDAPEGRGSSYLHEHVHVGDELELAGPLG
AFVCGSDTTRPVVLMSGGVGLTPLVSMLHRLRAMDGTRRVHFIHACENGAVHAFRREVEA
VAAAHPNVLAHFCYRQPLEEDRIAGHFHSEGLLSRETLQSLLPLDDYEVYLCGPPAFMQA
NWRLLRSLGVARERIHYEFFGPATVLDEDLDVPAPVRRVDTTARGTATVRFSPQDEPVAW
DPACASLLEFAEQHGHEPAFSCRIGICNTCVTRLVDGEVEYTETPLEPPAEGSVLLCCAK
PSGSVTLALSDDANTFD