Protein Info for QEN71_RS13610 in Paraburkholderia sabiae LMG 24235

Annotation: tRNA 2-selenouridine(34) synthase MnmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00581: Rhodanese" amino acids 14 to 125 (112 residues), 40 bits, see alignment E=2.2e-14 TIGR03167: tRNA 2-selenouridine synthase" amino acids 14 to 319 (306 residues), 361.3 bits, see alignment E=2.5e-112

Best Hits

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 93% identity to bph:Bphy_3699)

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>QEN71_RS13610 tRNA 2-selenouridine(34) synthase MnmH (Paraburkholderia sabiae LMG 24235)
MKSLLAPLDQIADFDEIVDVRTPLEFAEDHIPGAINAPVLSNEERVIIGTMYKQVSPFEA
TRLGAAMVSRNIAAHLETTFADRPRNWRPLIYCWRGGKRSGSMTTWFNLIGWRARQLDGG
YKTYRRNVIELLDTLPRQFRYIVLAGHTGSGKTRLLNALAGAHAQTLDLEALAAHRGSIL
GMLPNEAQPTQKAFDTALVGALRGFDTEQPVFVEAESRRIGSIALPASLTEQIHRGTCIR
VETERDERIRLLLQDYAHLFDNRTLFKSQLARLVELHGHARIEEWQKMIDADRRVELFEQ
LIDLHYDPAYARSTGKNFAKLPESTRFTLRPTDTDLHEQACALLARLR