Protein Info for QEN71_RS13285 in Paraburkholderia sabiae LMG 24235

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 148 to 214 (67 residues), 60.9 bits, see alignment E=1.1e-20 PF00027: cNMP_binding" amino acids 351 to 435 (85 residues), 55.6 bits, see alignment E=4.4e-19

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_3626)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>QEN71_RS13285 mechanosensitive ion channel family protein (Paraburkholderia sabiae LMG 24235)
MNNPLIFGFALVAFDVVIWRCAVPTNEVARLLVRLCIYAAFSALLFSSGLSPFSQAPYAD
SRPLHLLGQVLEIIWWLMGSRLLSMALDTLLLPKRWRRQRLFQDVFGALVFLAAVVAALG
FVLELPVRGLVATSGALAIVLGLAIQSTLSDVFAGIVINTTEPYHIGNWVIIDGVEGKVL
EMNWRATHLLTSQGNIVIVPNAVAAKAKITNTSRPPELHGITLMLEITPEARPSTVIAAL
EAALAGVRAVIADPAPYAIVKRTSANAVIYEATAYVDDTSKKLAVTNELYDLCYRQLEAA
GVPLRPLGAGYAAPAPALEADPRMNLLRRVDIFAALTPDELKGLSPLLSRRDYERGDTVV
TPDKVLDQLTIVDSGALSVVAEDASGPVEVTRLGPGDALGEAGLLAGMPARVTITALTAA
TVFQLKKDDLTPLLKDKPDVARLMCQMLSRRSDTLNKLGTPTPVAQSEQSVFQWLLDGMK
KLHDLTF