Protein Info for QEN71_RS13095 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 53 to 90 (38 residues), see Phobius details amino acids 94 to 98 (5 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 317 (268 residues), 146.6 bits, see alignment E=4.1e-47

Best Hits

Swiss-Prot: 47% identical to FRCC_RHIML: Fructose import permease protein FrcC (frcC) from Rhizobium meliloti

KEGG orthology group: K10553, fructose transport system permease protein (inferred from 98% identity to bph:Bphy_3593)

Predicted SEED Role

"Fructose ABC transporter, permease component FrcC" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>QEN71_RS13095 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSTPTVPAHNQRRFADHLPTLAEAGPLIALVLACIFFISQSNRFLSFQNLSLILQQTMVV
AVIAIGQTLIVLTGGIDLSCGMVMALGSIVMTKFAVVLGVPPAIAILCGVGASTLFGLLN
GVLITRIKLPAFIVTLGTLNIAFAVTQIYSNAESVSNLPDAIMFFGNTFNLGPATVTYGT
VLTLLMYLATWFVLRDTVPGRHLYALGNNPEAARLMGLSAQRILITVYTLSGAIYGIAAL
LSVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSIAGTLLGALIVGVFRNGLTLMG
VSSVYQVLITGILVILAVAADKLSRRGAR