Protein Info for QEN71_RS12970 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 406 to 425 (20 residues), see Phobius details PF01266: DAO" amino acids 34 to 386 (353 residues), 267.5 bits, see alignment E=6.1e-83 PF00890: FAD_binding_2" amino acids 34 to 66 (33 residues), 22.6 bits, see alignment (E = 1.4e-08) PF13450: NAD_binding_8" amino acids 37 to 102 (66 residues), 28 bits, see alignment E=5.6e-10

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 83% identity to bxe:Bxe_B0935)

Predicted SEED Role

"Putative oxidoreductase in putrescine utilization cluster"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>QEN71_RS12970 FAD-binding oxidoreductase (Paraburkholderia sabiae LMG 24235)
MLKFANQPHAASWYAATVNDSTRHPPLDDNISVDVCVIGAGLTGISTALNLAERGHSVAV
LEASKVGWAASGRNGGQMIGGFACDIDTFAKYMPESDVQRMWEMGLETLDIVKERVAKHR
IDCDLTLGYLTAANKPAHADALRAWRDDAKERFKYERFRYVERAQMDQYVQSSRYLGGLF
DPDSGHLHPLNYTLGLARAAVESGARIYEDSCVTALRSENGIHVVETERGTVRASYVVLA
CNTWLGSLAPDVSRKIMPVGTYVIATEPLDAQRAAALMPARAAVCDSRFVLDYFRPSTDN
RLLWGGKVSYSTFAPHNLGEAMRRDMLKTFPQLADVKVDYAWGGFVDITMNRAPHFGRLA
PTVYFAQGFSGHGVNTTGLAGKLIAQAIDGQASRFDLFGKIRHRDFPGGAMLRTPALVLA
MAWYRMKDLL