Protein Info for QEN71_RS12645 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 389 (365 residues), 158 bits, see alignment E=1.6e-50

Best Hits

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_3469)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>QEN71_RS12645 MFS transporter (Paraburkholderia sabiae LMG 24235)
MNRTSSDATLDAIVSQVMRRLLPFLLLMYVLAFLDRANIGFAQKALQHDTGISNAAFAFG
AGVFFVGYALFEVPSNLLLHRVGARLWMCRIMVTWGLVSAAMSLAHTATAFYTLRFLLGV
AEAGFFPGVIYYLTRWFPQSARARAVGVFYFGAPLAFMFGSPLSGFLLDLHGALDLAGWQ
WLFLIEGVLASIVGVWAFFYLDDRPEDARWLTPAARKTLSAALDDDARAAAAHGPHNLLA
ALVDRRVLLLSAIYLLIQMSVYGVIFYLPQQVAALMGESVGLRVGLVAAVPWICALALTW
YVPRRADATLTHRRWAVVLLVLAGCGIGVSGLAHSPLVALLALCCAASGFIAAQPLFWTF
PTRYLTGAAAAGGIALINSLGSLGGFIAPTLRTSAEHAFQSTSAGLLLLGAASLLAALLI
GTLMRRDASRDTSAFPQPIHRAR