Protein Info for QEN71_RS12640 in Paraburkholderia sabiae LMG 24235

Annotation: L-rhamnonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF02746: MR_MLE_N" amino acids 59 to 149 (91 residues), 43.1 bits, see alignment E=4.8e-15 PF13378: MR_MLE_C" amino acids 173 to 383 (211 residues), 158.4 bits, see alignment E=2.3e-50

Best Hits

Swiss-Prot: 98% identical to RHMD_PARP8: L-rhamnonate dehydratase (rhmD) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K12661, L-rhamnonate dehydratase [EC: 4.2.1.90] (inferred from 98% identity to bph:Bphy_3468)

MetaCyc: 78% identical to L-rhamnonate dehydratase (Sphingomonas sp. SKA58)
L-rhamnonate dehydratase. [EC: 4.2.1.90]

Predicted SEED Role

"L-rhamnonate dehydratase (EC 4.2.1.90)" in subsystem L-rhamnose utilization (EC 4.2.1.90)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>QEN71_RS12640 L-rhamnonate dehydratase (Paraburkholderia sabiae LMG 24235)
MAMPTIRHVRAFVVRGGGADYHDQADGHWIDDHISTPMARYPEYRQSRQSFGINVLGTLV
VEIEASDGTVGFAVTTGGEIGAFIVEKHLARFLEGQLVTDIEKMWDQMYFSTLYYGRKGV
VLNTISGVDLALWDLLAKVRKEPVYQLLGGPVRDELQFYATGARPDLAKQMGFIGGKLPL
QHNPAEGEEGLRKNIDKLAEMRNRVGDDFWLMYDCWMSLDVTYATKLAKAAHEHGLKWIE
EALSPDDYWGYAELRRNVPRGMMVSTGEHEATRWGFRMLLEMGCCDLIQPDVGWCGGITE
LIKISALADAHNVLVVPHGSSVYSYHFVVTRHNSPFAEFLMMAPKADQVVPMFTPLLLDE
PVPVNGRMKVPETPGFGVRLNPECKLERPYQH