Protein Info for QEN71_RS12635 in Paraburkholderia sabiae LMG 24235

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 6 to 206 (201 residues), 154.1 bits, see alignment E=5e-49 PF08659: KR" amino acids 8 to 176 (169 residues), 45.5 bits, see alignment E=1.3e-15 PF13561: adh_short_C2" amino acids 15 to 255 (241 residues), 202.5 bits, see alignment E=1.2e-63

Best Hits

Swiss-Prot: 58% identical to RM1DH_PICST: L-rhamnose-1-dehydrogenase (DHG2) from Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_3467)

MetaCyc: 64% identical to NAD(P)+-dependent L-rhamnose 1-dehydrogenase (Azotobacter vinelandii NBRC 102612)
RXN-12158 [EC: 1.1.1.378]; L-rhamnose 1-dehydrogenase. [EC: 1.1.1.378, 1.1.1.173]

Predicted SEED Role

"L-rhamnose-1-dehydrogenase ( EC 1.1.1.173)" in subsystem L-rhamnose utilization (EC 1.1.1.173)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.173 or 1.1.1.378

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>QEN71_RS12635 SDR family NAD(P)-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MLLKDKSVIVTGGSRGIGRAIAVACAREGADVAINYWGDNDASYGRRSAVDEVVDEIQAL
GRRVIAVEGNVALRSTGVELVARTVDAFGKVDVLASNAGICPFHAFLDMPADVLETTVAV
NLNGAFFVTQAAAQQMKAQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVA
LGPFGIRCNSVMPGTIATDLNAEDLADDAKKAYFEKRIPLGRLGQPDDVAECVVFLASDR
ARYVTGAALLVDGGLFVNLQ