Protein Info for QEN71_RS12625 in Paraburkholderia sabiae LMG 24235

Annotation: L-rhamnose mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF05336: rhaM" amino acids 4 to 103 (100 residues), 98.3 bits, see alignment E=1.5e-32

Best Hits

Swiss-Prot: 91% identical to RHAM_PARP8: L-rhamnose mutarotase (rhaM) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 91% identity to bph:Bphy_3465)

MetaCyc: 54% identical to L-rhamnose mutarotase monomer (Rhizobium leguminosarum bv. trifolii)
RXN0-5306 [EC: 5.1.3.32]

Predicted SEED Role

"L-rhamnose mutarotase" in subsystem L-rhamnose utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-

Use Curated BLAST to search for 5.1.3.- or 5.1.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>QEN71_RS12625 L-rhamnose mutarotase (Paraburkholderia sabiae LMG 24235)
METIAFRMVLNPGMRDEYERRHREIWPELVDALHNAGVRDYRIFLDDDSHHLFAILTRTA
DHSMERLPELAVMRKWWDYMADIMQTAPDHTPLQQPLIPVFELQHPFN