Protein Info for QEN71_RS12625 in Paraburkholderia sabiae LMG 24235

Annotation: L-rhamnose mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05336: rhaM
  • amino acids 4 to 103 (100 residues), 98.3 bits, E=1.5e-32

Best Hits

Swiss-Prot: 91% identical to RHAM_PARP8: L-rhamnose mutarotase (rhaM) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 91% identity to bph:Bphy_3465)

MetaCyc: 54% identical to L-rhamnose mutarotase monomer (Rhizobium leguminosarum bv. trifolii)
RXN0-5306 [EC: 5.1.3.32]

Predicted SEED Role

"L-rhamnose mutarotase" in subsystem L-rhamnose utilization

MetaCyc Pathways

• L-rhamnose degradation I (2/5 steps found)
• superpathway of fucose and rhamnose degradation (5/12 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-

Use Curated BLAST to search for 5.1.3.- or 5.1.3.32

Protein Sequence (108 amino acids)

>QEN71_RS12625 L-rhamnose mutarotase (Paraburkholderia sabiae LMG 24235)
METIAFRMVLNPGMRDEYERRHREIWPELVDALHNAGVRDYRIFLDDDSHHLFAILTRTA
DHSMERLPELAVMRKWWDYMADIMQTAPDHTPLQQPLIPVFELQHPFN