Protein Info for QEN71_RS12605 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 275 to 291 (17 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 312 (266 residues), 142.8 bits, see alignment E=5.9e-46

Best Hits

Swiss-Prot: 32% identical to LSRD_SALPA: Autoinducer 2 import system permease protein LsrD (lsrD) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K10820, monosaccharide-transporting ATPase [EC: 3.6.3.17] (inferred from 96% identity to bph:Bphy_3461)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 1" in subsystem L-rhamnose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>QEN71_RS12605 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MAKPDSALLTRKRETPLRWETLLVVVLIASLGLGRVLSPVFLTGANLSNVLADLTEIALM
ALPMTLIIVAAEIDLSVASVLGASSALMGVLWHMGLPMPVVIVLVLVFGMIAGLFNGLVI
VKLNLPSLAVTIGTLALFRGLSYVLLGDQAVADFPAGYTAFGMDTLFGTFIPLPFVIVIV
CAVLFTVLLQSTAFGRSLYAIGANPTAAAFSGIEVAKVRLRLFVLSGFMSALAGIVYTLR
FTSARGDNGEGFELSVIAAVLFGGVSIFGGRGSMVGVLLSLLIIGVLKNALTLDDVSSET
LTIVTGALLLASVLIPNLVARWRAMRDRKLIAAQTLTKPSAP