Protein Info for QEN71_RS11790 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 44 to 170 (127 residues), 101.9 bits, E=4.8e-33

Best Hits

Swiss-Prot: 85% identical to SSUB3_PARXL: Aliphatic sulfonates import ATP-binding protein SsuB 3 (ssuB3) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 85% identity to bxe:Bxe_C0982)

MetaCyc: 47% identical to aliphatic sulfonate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Protein Sequence (247 amino acids)

>QEN71_RS11790 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MSASIALLRDANPAVRVDSRVGPSSLAVSVRGLQRRYGARVVIDALDLDIHQGEFVALLG
ESGCGKTTLLRALAGLDLPDNGQIRAPERPSVVFQEHRLLPWATLWENVALGHETTVGRE
GASRALAEVGLAGRENDWPRNLSGGQAQRVALARALVRDPALLLLDEPFAALDALTRIKM
HGLVRELVARHQPGVLIVTHDVDEALTLADRILVMRAGRIAASFRPKADTPQALRPILLN
ELGVQSQ