Protein Info for QEN71_RS11430 in Paraburkholderia sabiae LMG 24235

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 162 to 180 (19 residues), see Phobius details PF08240: ADH_N" amino acids 25 to 129 (105 residues), 109.1 bits, see alignment E=2.1e-35 PF16912: Glu_dehyd_C" amino acids 151 to 333 (183 residues), 41.5 bits, see alignment E=2.1e-14 PF01262: AlaDh_PNT_C" amino acids 159 to 216 (58 residues), 25.3 bits, see alignment E=1.9e-09 PF00107: ADH_zinc_N" amino acids 169 to 294 (126 residues), 76.4 bits, see alignment E=4.1e-25

Best Hits

KEGG orthology group: None (inferred from 91% identity to bpy:Bphyt_5476)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>QEN71_RS11430 zinc-binding alcohol dehydrogenase family protein (Paraburkholderia sabiae LMG 24235)
MLSVICESPGVLRHEDRELPLRADGEVLLRVRRVGICGTDMHIYSGNQPYLQYPRVMGHE
LSATVVEADPGAHVTSGDTVYVMPYLSCGHCIACRQGKTNCCVNIKVLGVHSDGALTEYL
SVPAQFVHRAEGVTLDQAAMLEFLAIGAHAVRRADVSAGQRVLVVGAGPIGMAAVLFATL
RGASVTCLDTRADRLAFCREHFAVSTVEIGANDVEELSALTGGEFFDVVFDATGNVKAMN
RGFAFIAHGGKYVLISIVPGEISFSDPEFHKREATLLGSRNATAKDFETVLDAMRAGRIP
DKALNTHRMSLSDVPTEFPKLLEPGRTVVKALVEC