Protein Info for QEN71_RS11335 in Paraburkholderia sabiae LMG 24235

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00005: ABC_tran" amino acids 19 to 178 (160 residues), 124.5 bits, see alignment E=4.9e-40 PF13304: AAA_21" amino acids 146 to 208 (63 residues), 28.7 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 68% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10017, histidine transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 73% identity to bge:BC1002_6186)

MetaCyc: 37% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>QEN71_RS11335 ATP-binding cassette domain-containing protein (Paraburkholderia sabiae LMG 24235)
MNALTVENLHKRYGDNEVLKGVSLSAKRGDVISMIGSSGSGKSTFLRCINFLESPSSGRV
SLNGSEVRTSTGGKGEIRISDPAQLRQMRTRLAMVFQHFNLWAHMTVLENVMEAPRHVLK
LTKPEAIERAQRYLEQVGMTRFANAYPSHLSGGQQQRVAIARALAMEPEALLFDEPTSAL
DPELVGDVLKVMRDLAEEGRTMIVVTHEMGFAREVSNHVVFLHQGVVEEEGHPKEVLKTP
KSERLQRFLSGAMK