Protein Info for QEN71_RS11310 in Paraburkholderia sabiae LMG 24235

Annotation: C4-dicarboxylate transporter DctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 127 to 139 (13 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 299 to 340 (42 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF00375: SDF" amino acids 10 to 401 (392 residues), 316.9 bits, see alignment E=1e-98

Best Hits

Swiss-Prot: 52% identical to DCTA_LARHH: C4-dicarboxylate transport protein (dctA) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: None (inferred from 92% identity to bge:BC1002_1258)

MetaCyc: 50% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>QEN71_RS11310 C4-dicarboxylate transporter DctA (Paraburkholderia sabiae LMG 24235)
MRLARPLRLLYVQVLLAMLSGMALGHFWPPAGALLKPLSDAFVGLVRMMIAPIVFCTIVS
GITSLASGKAIGRKIIQALALFYFLTAVALMLGLAVAFALRPGAGMHIDVHHLDSSILVQ
YAKHAQAGGLVAFGLSVIPETIVGAFEKGEVLPVLLLSLLFGFSLNSCPSAGRPVLALID
GVAQIFFRVLAMIMRLAPLGAFGAMAFTVGRFGIRSVGSLGMLMVSFYVACLLFVALVLA
PLARLHGFALWRLLRYMREELLIVLATSSTEPVLPRLIVKLEALGCDKGVVGLVLPAGYS
FNLDGTAIYLTLASMFIAQACDVPLSATQIATMLAVMLLTSKGAAGVSGSGLVALVATLT
VIPDLPVAGVALLVGIDRFMSEARALTSVISNACAVIFVSMWEGACDRARLAQMLRAAEP
GRTDVANDPATDTLR