Protein Info for QEN71_RS10465 in Paraburkholderia sabiae LMG 24235

Annotation: benzoate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13577: SnoaL_4" amino acids 11 to 66 (56 residues), 24.3 bits, see alignment E=2.7e-09 TIGR03232: benzoate 1,2-dioxygenase, small subunit" amino acids 14 to 167 (154 residues), 291.2 bits, see alignment E=8.3e-92 PF00866: Ring_hydroxyl_B" amino acids 19 to 160 (142 residues), 164.3 bits, see alignment E=2e-52

Best Hits

Swiss-Prot: 70% identical to BENB_ACIAD: Benzoate 1,2-dioxygenase subunit beta (benB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05550, benzoate 1,2-dioxygenase beta subunit [EC: 1.14.12.10] (inferred from 95% identity to bph:Bphy_5351)

MetaCyc: 64% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>QEN71_RS10465 benzoate 1,2-dioxygenase small subunit (Paraburkholderia sabiae LMG 24235)
MSTIATTPTLAELQAYLYREARLLDDEQWDEWLDLYHPDAVFWMPSWDDTDKLITDPQRE
ISLIYYPSRQGLEDRIFRIKTERSSATIPDTRTCHNISNVELESHDDGVCTVRFNWHTLS
HRYKTNYSYFGMSRYVIDFNSESPRILNKYVVLKNDYINQVIDIYHI