Protein Info for QEN71_RS10065 in Paraburkholderia sabiae LMG 24235

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 PF01627: Hpt" amino acids 11 to 100 (90 residues), 51.7 bits, see alignment E=1.7e-17 PF02518: HATPase_c" amino acids 336 to 473 (138 residues), 54.6 bits, see alignment E=2.7e-18 PF01584: CheW" amino acids 480 to 608 (129 residues), 66.1 bits, see alignment E=5.2e-22 PF00072: Response_reg" amino acids 635 to 747 (113 residues), 88.5 bits, see alignment E=6.9e-29

Best Hits

KEGG orthology group: K13490, two-component system, chemotaxis family, sensor histidine kinase and response regulator WspE (inferred from 92% identity to bph:Bphy_5391)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (756 amino acids)

>QEN71_RS10065 hybrid sensor histidine kinase/response regulator (Paraburkholderia sabiae LMG 24235)
MTDDDLSRQSLLELFREEASAQTRVLSDGLLSLEQRPADAAALEACMRAAHSLKGAARII
GLQDGVDIAHLMEECFVGAQRGELRLTPAHIDVLLRGVDLLLRVGEAKPDAPVTRADIDE
FVRRLSTPEPAAQQTVGNDVDVYAQLQAQLQAEALAQRHEAAPTDATEKADTARHADRML
RVRAANLDRVLSLSGEALVESRWLKPFATSMLRMKRTQRETSLALDALYDTLAGHLDEVA
LSALADVRTALNGMQQTLGARIDELDHYERSSANLAQLLYDEALQCRMRPFGDATHAYPR
VVRDLARSLGKRVTFEIVGTSTQVDRDILDMLDAPLGHLLRNAIDHGIETPEQRISRGKP
ADAHVTLEARHSAGKLLISVSDDGAGIDLDNVRASVIRRKLADADTAARLSEQELLDFLL
LPGFSMRDQVTDVSGRGVGLDAVHEMVKAVRGTVRIFNDPGKGSRFVMQLPLTLSVVRSL
LVDVGGEAYAFPLAHVRRTLELARADIDMLEGQQHFSFDGKPVGLVSAHQLLGAQQVSAA
ARESVSVVVIGDERETYGIAVDRFLGERMLVVQPLDARLGKIKDIAAGALMENGDAVLIV
DVDDLLRSVDKLVRGGQLDKIGRAHDVTARQRKHVLVVEDSLTVRELERKLLEKRGYAVT
VAVDGMDGWNALRSGRFDLVVTDIDMPRMDGIELVTLIKRDPVFKPVPVMIVSYKDRDED
RRRGLEAGADYYLAKGSFHDEALLDAVRDLIGEATE