Protein Info for QEN71_RS09985 in Paraburkholderia sabiae LMG 24235

Annotation: type II toxin-antitoxin system YhaV family toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF11663: Toxin_YhaV" amino acids 14 to 150 (137 residues), 201.4 bits, see alignment E=3.1e-64

Best Hits

Swiss-Prot: 47% identical to YHAV_ECOL6: Toxin YhaV (yhaV) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 65% identity to afr:AFE_1412)

MetaCyc: 47% identical to ribosome-dependent mRNA interferase toxin YhaV (Escherichia coli K-12 substr. MG1655)
Physarum polycephalum ribonuclease. [EC: 3.1.26.1]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>QEN71_RS09985 type II toxin-antitoxin system YhaV family toxin (Paraburkholderia sabiae LMG 24235)
MTIRDVLKVNGWTIYAHPCFLDQFESLVKQVEALRRKLPNDFHKKNDAKRLAAIAKLAWE
VIPDNPEKEEYRQGETLGDDRKHWFRAKFFQQYRLFFRYHKASRIIILAWVNDETTRRAY
GCTTDAYKVFARMLNKGRPPDDWNTLLAEASSSDAHEVLLSVHKATGN