Protein Info for QEN71_RS09775 in Paraburkholderia sabiae LMG 24235

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 59 to 75 (17 residues), see Phobius details PF00356: LacI" amino acids 3 to 48 (46 residues), 56.2 bits, see alignment 4.7e-19 PF00532: Peripla_BP_1" amino acids 62 to 276 (215 residues), 56.3 bits, see alignment E=7.5e-19 PF13407: Peripla_BP_4" amino acids 143 to 278 (136 residues), 44.3 bits, see alignment E=3.4e-15 PF13377: Peripla_BP_3" amino acids 172 to 331 (160 residues), 120.1 bits, see alignment E=2.1e-38

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 96% identity to bph:Bphy_5439)

Predicted SEED Role

"Transcriptional regulators"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>QEN71_RS09775 substrate-binding domain-containing protein (Paraburkholderia sabiae LMG 24235)
MATLKDVAELAGVGLSTASRAISGKGPVSAEAAARVKAAIAELNFRPSSIGRAMATQQLG
IIGLFVPTFFGSYYGTILKQTDLELRSVHRHVVVATGCGESTPREQALEAVRFLIGRDCD
GVVVISHDLHDEDLDELHRLHPKMVFLNRAFDALPDASFCPDHRRGGELAAATLLEHGHR
RVAVISGPYTASDNVERLDGFFEELARHGIARETVPLIESDFSPEGGYAATCRLLESKVP
FTGLFCANDTMAVSALARFQQLGISVPGDVSVIGYDDDYSAAYSAPALTSVHIPTAELTQ
NAVRWLINQCYGTKWEIFREFPVTVSMRASVGRPKVN