Protein Info for QEN71_RS09700 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 35 to 308 (274 residues), 64.6 bits, see alignment E=1.2e-21 PF00005: ABC_tran" amino acids 373 to 521 (149 residues), 112 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 95% identity to bph:Bphy_5449)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (622 amino acids)

>QEN71_RS09700 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MASKKLDFGAQAFRSVLGFTFIHWRRQPVRVAGIAAFALLAAFADVLTPLFAGRLVDALA
SGTTLGKDVASHPALSAFGVLIALGIGGTLLRQLVYRSIIVMTLKMMSAICANAFHRVQR
FSTDWHANSFAGSTVRKITRGIWALDLLNDTLLIALLPSLVMLAGSTVLLGIHWPVMGLV
VGVGSLLYVVVTVALSLGYVAPAARLGNLWDTRMGGSLADAVSCNAVVKAFGAEEREEAR
LERVIDKWRQRTRRTWQRGTTNGGVQGAMLAAMQAAILGAALLLWLRDEASVGDITYALT
TFFVLQGYLRDVGMHVRNLQRSVNDMEELVALEREPLGIEDKPGARAIEIGQGEIRFDHV
TFRYGAQRTALYNDFSLRIAPGERIGLVGHSGSGKTTFIKLIQRLYDIDEGSITIDGQNI
ADVQQASLRRRIAIVQQEPVLFHRSLAENIAYARPGASFDDIVQAAKLASAHDFITALPH
GYDTLVGERGVKLSGGERQRVAIARAFLADAPILIFDEATSSLDSESEVLIQQAMERLMV
GRTTLVVAHRLSTVRALDRLLVLDKGRVVEEGSHEQLIRIDNGVYRRLFERQALELTKGL
LDDGPVRTSERFTGDPSLIAGK