Protein Info for QEN71_RS09530 in Paraburkholderia sabiae LMG 24235

Annotation: isoprenylcysteine carboxylmethyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details PF04191: PEMT" amino acids 91 to 189 (99 residues), 54.3 bits, see alignment E=1.7e-18 PF04140: ICMT" amino acids 93 to 182 (90 residues), 31.7 bits, see alignment E=1.7e-11

Best Hits

Predicted SEED Role

"Putative protein-S-isoprenylcysteine methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>QEN71_RS09530 isoprenylcysteine carboxylmethyltransferase family protein (Paraburkholderia sabiae LMG 24235)
MHFGDSIFWRLLPLVHAGVFGATAVLGRIWIARTNRHDAVSFSREQSARDFVARCFYFWL
PVIDGLFLAFYGLTGERGSVIANLLDNEFIRWIGVACMAIALIWVVCSQAAMGSAWRMGV
DSRTPTELITKGPFALSRNPIYLGIRATILGQLLIVGSWPVFAIWAMSELLVQVQVRFEE
EHMFRLHAQRYAEYCARVRRWL