Protein Info for QEN71_RS09330 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02866: cytochrome c oxidase, subunit II
  • amino acids 27 to 219 (193 residues), 156.2 bits, E=4.1e-50
• PF00116: COX2
  • amino acids 134 to 208 (75 residues), 67.6 bits, E=9.3e-23
• PF00034: Cytochrom_C
  • amino acids 236 to 323 (88 residues), 43.5 bits, E=6.7e-15

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 88% identity to bph:Bphy_5491)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Protein Sequence (324 amino acids)

>QEN71_RS09330 cytochrome c oxidase subunit II (Paraburkholderia sabiae LMG 24235)
MAAHREAFGAPLDYFLHAGGPAAEPSMHLGWALTALSMSVVVIIALLLVIAIARRRRVPA
DARLAQGETTALRWIYAGTGISSVALIAALAYTLVTLDSVAAPSRDPALTLTVTAYDWWW
KVEYGAAGDAPAFVTANEIHIPVGEPVKIVLQSADVIHAFWVPQLAGKTQTIPGQTNEQW
IQADAPGVYRGQCSQFCGAQHAHMAFEVVAQDRAGFDAWRRAQAQPATRVAADALAAHGE
QLFHARCAGCHAVRGTDANGAQAPDLTHLNSRGLIAAGALTNTPEHQLDWIRHAQRIKPD
SLMPSIVLTSSEASALSAYLATLH