Protein Info for QEN71_RS09220 in Paraburkholderia sabiae LMG 24235

Annotation: TAXI family TRAP transporter solute-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 27 to 293 (267 residues), 91.3 bits, see alignment E=2.6e-30 PF16868: NMT1_3" amino acids 71 to 282 (212 residues), 72 bits, see alignment E=6.4e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to bph:Bphy_5501)

Predicted SEED Role

"FIG00467904: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>QEN71_RS09220 TAXI family TRAP transporter solute-binding subunit (Paraburkholderia sabiae LMG 24235)
MPRDHKLERSRKTPMTPGRRWLIGVGAVVLLIVLGWGLYTVIEPAFQTRIVITTGADKGI
YRGFAERYAPLLKRDGVTLDIRSSSGSVENYQRLKDPASEYQVGFIQSGTTVPQETDQLQ
TIAAVSYEPIWVFYRDTATVNRLAQLRGKRIGVGVPGSGLGEVSRVLLDYSGITGDNTQI
VEMDAPKAWRCLEDGCLDAAFFIGRPDAPMQQMLLNSDLKLMSFAQADALVQKFPSLKKV
TFPRASTSIVNDSPQTDVTLLAATALLVAKDTLHPALVYLLLDAAKTVHAGEDYFTPLGA
FPNLNTDEFPVASESERYFKSGRPFLQRYLPFWLASFIERRLLILLPFMAVLIGVVQALP
RMLESRIKKRFVAGYRALKRLEDEIWKTTRPSAEQVSRWRDEIEHIDAQASQIRVPTRYL
HDVYALKQAISVVRHRISTAAAGVSE