Protein Info for QEN71_RS09185 in Paraburkholderia sabiae LMG 24235

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF03976: PPK2" amino acids 11 to 235 (225 residues), 325.9 bits, see alignment E=7.2e-102 TIGR03707: polyphosphate kinase 2" amino acids 11 to 237 (227 residues), 367.5 bits, see alignment E=1.5e-114

Best Hits

Swiss-Prot: 58% identical to PK21C_RHIME: Polyphosphate:ADP phosphotransferase 3 (SMa0670) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_5508)

Predicted SEED Role

"FIG00464652: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>QEN71_RS09185 polyphosphate kinase 2 (Paraburkholderia sabiae LMG 24235)
MHGSAKASGRLDNKQYEKELKALHIELVKLQEWVVQTGAKVCVVFEGRDGAGKGGTIKAI
TERVSPRVFRVIALPAPTDREKTQMYIQRYLPHLPAAGEIVLFDRSWYNRAGVERVMGFC
TEEQVENFFKAVPLIEHAIIQSGIILLKYWLEVSEDEQTRRLEARITDERKIWKLSPMDL
RSYSRWYDYSRARDEMFAATDTDQAPWYVVRSDDKKRARLNLITHLLDSIPYKTMPRQKI
KLPKRQKTEGYRQPDRPARYVPEKF