Protein Info for QEN71_RS08630 in Paraburkholderia sabiae LMG 24235

Annotation: DNA-3-methyladenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR00567: DNA-3-methyladenine glycosylase" amino acids 14 to 196 (183 residues), 156.7 bits, see alignment E=2.6e-50 PF02245: Pur_DNA_glyco" amino acids 18 to 192 (175 residues), 184.4 bits, see alignment E=6.6e-59

Best Hits

Swiss-Prot: 88% identical to 3MGH_PARP8: Putative 3-methyladenine DNA glycosylase (Bphy_3243) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03652, DNA-3-methyladenine glycosylase [EC: 3.2.2.21] (inferred from 88% identity to bph:Bphy_3243)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>QEN71_RS08630 DNA-3-methyladenine glycosylase (Paraburkholderia sabiae LMG 24235)
MTKTTHSLVPLHRNDLPVDTVDLARFLLGKYLVHDLPEGRAAGRIVETEAYPVGDSTNHA
YPGRRAYNGSMFLERGHAYVRLTYGIYNVINVVSEHAGTGAAVLIRALEPVEGIESMQAR
RPGTKPRDLTRGPGRLALALGIGLGFDGADLCTGHGLWLGATDQAQTPFAVTTRIGIARE
THRLLRFYVPGSSFVSGPRKLLTGEMPPSS