Protein Info for QEN71_RS08355 in Paraburkholderia sabiae LMG 24235

Annotation: glycine betaine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04069: OpuAC
  • amino acids 30 to 273 (244 residues), 237.2 bits, E=1.2e-74

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 99% identity to bph:Bphy_3294)

Predicted SEED Role

"Glycine betaine/L-proline ABC transporter, glycine betaine/L-proline- binding/permease protein" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Protein Sequence (287 amino acids)

>QEN71_RS08355 glycine betaine ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MKHLKKLMLCGALIASMTAIGTAAADTKPTIKIGYVEGWDDSVATSNVAAQIIEKRLGYP
VQLVPVAAGIMWQGVARGDLDATLSAWLPVTHGAYWDQFKGKVQDLGANYTDAKIGLIVP
ADVPEKSISDLQAHKADFSGRIVGIDAGAGVMKKTSEAIKAYNLDYQLMPSSGSAMTAEL
ARSMNANKPVIVTGWVPHWMFAKWKLKFLEDPKKVYGESEHVDSVVNPGLDTKAPQVVAF
LKKFQWKPGEIDSVMLATENGAKPADAAGSWIAAHGDRVNSWVGGAQ