Protein Info for QEN71_RS08180 in Paraburkholderia sabiae LMG 24235

Annotation: transcriptional regulator BetI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR03384: transcriptional repressor BetI" amino acids 2 to 190 (189 residues), 259.8 bits, see alignment E=7e-82 PF00440: TetR_N" amino acids 14 to 59 (46 residues), 38.3 bits, see alignment 9.1e-14 PF13977: TetR_C_6" amino acids 83 to 191 (109 residues), 116.7 bits, see alignment E=6.3e-38

Best Hits

Swiss-Prot: 99% identical to BETI_PARP8: HTH-type transcriptional regulator BetI (betI) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02167, TetR/AcrR family transcriptional regulator, transcriptional repressor of bet genes (inferred from 99% identity to bph:Bphy_3308)

Predicted SEED Role

"HTH-type transcriptional regulator BetI" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>QEN71_RS08180 transcriptional regulator BetI (Paraburkholderia sabiae LMG 24235)
MPKVGMREVRRAQLIDATLLTIDQSGLSGTTLASVAQRANISTGIVSHYFGDKDGLLEAT
MRHILRDLWAATTRRRIAAKSQPRARLRAIVAANFDVSQVSGPVMKTWLAFWSESMHEPA
LRRLQHVNTRRLYSNLCAEFAKELPRASARRAASGLAAMIDGLWLRGALSGDPFDTKAAL
RLANDYIDLLLAQSAA