Protein Info for QEN71_RS07995 in Paraburkholderia sabiae LMG 24235

Annotation: proline racemase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF05544: Pro_racemase" amino acids 10 to 332 (323 residues), 358.3 bits, see alignment E=1.9e-111

Best Hits

Swiss-Prot: 81% identical to T3HPD_BURCH: Trans-3-hydroxy-L-proline dehydratase (lhpH) from Burkholderia cenocepacia (strain HI2424)

KEGG orthology group: K01777, proline racemase [EC: 5.1.1.4] (inferred from 95% identity to bph:Bphy_3344)

MetaCyc: 81% identical to trans-3-hydroxy-L-proline dehydratase subunit (Azospirillum brasilense)
Trans-L-3-hydroxyproline dehydratase. [EC: 4.2.1.77]

Predicted SEED Role

"Not a Proline racemase, nor 4-hydroxyproline epimerase [missing catalytic residues]" in subsystem Proline, 4-hydroxyproline uptake and utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.4

Use Curated BLAST to search for 4.2.1.77 or 5.1.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>QEN71_RS07995 proline racemase family protein (Paraburkholderia sabiae LMG 24235)
MKLNRVISTVEVHTGGEPFRIVTSGLPKIPGKSIVERRAWLKEHADHLRRALMLEPRGHA
DMYGGYLTDPVSEGADFGIIFVHNEGYSDHCGHGVIALATTAVALGWVERTEPETRVGID
APCGFIEAFVKWDGDHAGSVRFVNVPSFIWQRDVSVETPSFGTVRGDIAFGGAFYFYTSG
EPFGLDVRESHVDRLIQFGAEVKRAANEAFKVQHPHIPEINHIYGTIIDNAPRHAGSTQA
NCCVFADREVDRSPTGSGTAGRVAQLYLRGQLGKDETLVNESIIGTVFRGRVLSETKLDR
FDAVIPEIEGDAHICGFANWIVDERDPLTYGFLVR