Protein Info for QEN71_RS07855 in Paraburkholderia sabiae LMG 24235

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 166 to 180 (15 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 26 to 135 (110 residues), 84.5 bits, see alignment E=1.4e-27 PF12697: Abhydrolase_6" amino acids 28 to 281 (254 residues), 67.7 bits, see alignment E=3.7e-22 PF12146: Hydrolase_4" amino acids 28 to 113 (86 residues), 28.9 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 74% identity to bpy:Bphyt_4876)

Predicted SEED Role

"Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>QEN71_RS07855 alpha/beta fold hydrolase (Paraburkholderia sabiae LMG 24235)
MIRDVQTVDADGVQLAVYVSGPRDAPPVVLVHGYPDSAAVWEPIRALLEPRYRVIAYDVR
GAGASDAPRERASYRLERLAADLNSVADATCGARPFHLVGHDWGSIQCWEAVTNDALQGR
IASFTSISGPCLDHASLGLRGDRAQRSARPFGAGVRQMLKSWYIVFFHLPILPELVWPLG
GAYGWPLWLRATERVRAPRDPAQLRNALNGLQLYRANFIEKLLRPRARRAHAPVHFIVPL
RDRYVGSALTLGLDAWIGPHSRDEIDAGHWVVLRDPKRVAASIERFVDTCEASLQTIGSV
RVNIVG