Protein Info for QEN71_RS07735 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 118 (106 residues), 67.1 bits, see alignment E=7.9e-23 PF00528: BPD_transp_1" amino acids 42 to 224 (183 residues), 63.5 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 50% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10019, octopine/nopaline transport system permease protein (inferred from 98% identity to bph:Bphy_5102)

Predicted SEED Role

"ABC-type arginine/histidine transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>QEN71_RS07735 ABC transporter permease subunit (Paraburkholderia sabiae LMG 24235)
MSFDFDFLFDTLRQLLGAVPTTLGLFFSSLVLGGLLSLVIVTMRVSPHWLPNRFARAYIL
VFRGSPLLIQMFLVYYGLGQFGVIRESFLWPVLREPYVCAVLSLALCTAGYTAEIIRGGL
MAVPVGQIEAGYSIGLSGFSLLRRIIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEV
TGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGLLERRLSQHLRAMPVNAAPRAIP
SATEARRAAP