Protein Info for QEN71_RS07640 in Paraburkholderia sabiae LMG 24235

Annotation: malonate decarboxylase holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF20866: MdcG_N" amino acids 24 to 93 (70 residues), 50.6 bits, see alignment E=1.6e-17 TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase" amino acids 30 to 223 (194 residues), 142.9 bits, see alignment E=6.1e-46 PF10620: MdcG" amino acids 105 to 224 (120 residues), 108.1 bits, see alignment E=2.8e-35

Best Hits

Swiss-Prot: 42% identical to MDCG_PSEAE: Phosphoribosyl-dephospho-CoA transferase (mdcG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13934, phosphoribosyl-dephospho-CoA transferase [EC: 2.7.7.66] (inferred from 79% identity to bph:Bphy_5082)

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>QEN71_RS07640 malonate decarboxylase holo-ACP synthase (Paraburkholderia sabiae LMG 24235)
MRVCAAAPFASPDVLLGCDTRWHAHDILRVRRLETFDNEPAWVRDAFARAPFVVVRRAQA
AAGFLAIGVRGAARNERYGTWARSEDIEAVFRPEALLSRASELAKERAALPVFVALDALR
RDASCFDSFTWGPTGSSGFELATGTPTVTTTSDLDLLIRMPNHLTLDDASRIQTALDQHA
ARTGVRIDAQLETPAGGVALTEYALRKARVMARHANGPQLVADPWAMSSAQTCL