Protein Info for QEN71_RS07350 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 86 to 117 (32 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 325 to 341 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 73 to 336 (264 residues), 174.8 bits, see alignment E=1.1e-55

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 96% identity to bph:Bphy_1235)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>QEN71_RS07350 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MNDQRVTGKDSTAAPTGAATASTADPSAPLASGKPAGTRLGFSNYLGLAGALVAMIALFS
VLSSHFLTYDTFITIANQIPDLVVMSVGMTFVLIIAGIDLSVGSVLALGASVVSVAALKW
QLGPLAAAALGLVAAALTGTVTGAVTVGWRIPSFIVSLGVLEAARGLAYQMTNSRTAYIG
DAFDFLSNPIALGISPAFLIAVAVMIVAQLVLTRTVFGRYLVGIGTNEEAVRLAGVNPKP
YKVIVFALMGALSGLAALFQISRLEAADPNAGVGLELQVIAAVVIGGTSLMGGRGSVIST
FFGVLIISVLAAGLAQIGANEPTKRIITGAVIVVAVVLDTYRSRRKRS