Protein Info for QEN71_RS07330 in Paraburkholderia sabiae LMG 24235

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 268 to 287 (20 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 29 to 325 (297 residues), 214.4 bits, see alignment E=1.3e-67 PF01544: CorA" amino acids 32 to 320 (289 residues), 189.3 bits, see alignment E=5.1e-60

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 96% identity to bph:Bphy_1239)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>QEN71_RS07330 magnesium/cobalt transporter CorA (Paraburkholderia sabiae LMG 24235)
MLINCAAYQDGRKLADIEIDDISVYVAKPECFVWVALKDPGPGELEVMKHEFGLHELAVE
DVRHGHQRPKIEEYGDSIFAVMHTIETDDDGEFVIGEVDVFVGSNYVLSVRRGTRHGFQE
VRARCEREPQLLKEGAAFVLYALADNVVDRYFPILEAMGTEIEEIEDRIFDKHDLAASRA
IIEDLYSLKRRLVTLQHHIEPLLEGISKLVGGRIPAICVGMQAYFRDVYDHLDRIVRTIE
GRREIIVTAVQVNLGMISLAENEVTKRLGSFAALFAVPTMIAGIYGMNFQEIPELHFKYG
YPICLLAMLLIDLVLYRGFKKANWL