Protein Info for QEN71_RS07090 in Paraburkholderia sabiae LMG 24235

Annotation: ABC-F family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 PF00005: ABC_tran" amino acids 10 to 176 (167 residues), 72 bits, see alignment E=3.2e-23 amino acids 327 to 458 (132 residues), 72.4 bits, see alignment E=2.4e-23 PF12848: ABC_tran_Xtn" amino acids 216 to 301 (86 residues), 77.7 bits, see alignment E=2.4e-25

Best Hits

Swiss-Prot: 67% identical to YBIT_ECO57: Uncharacterized ABC transporter ATP-binding protein YbiT (ybiT) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to bph:Bphy_1285)

Predicted SEED Role

"ATPase components of ABC transporters with duplicated ATPase domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>QEN71_RS07090 ABC-F family ATPase (Paraburkholderia sabiae LMG 24235)
MQFGPKPLFENISVKFGEGNRYGLIGANGCGKSTFMKILGGDLEQSSGNVMLEPNVRLGK
LRQDQFAYEDVRVLDVVMMGHTEMWAAMTERDAIYANPEATDDDYMHAAELEAKFAEYDG
YTAEARAGELLLGIGISIDLHNGPMSNVAPGWKLRVLLAQALFSKPDVLLLDEPTNNLDI
NSIRWLEDVLNEYDSTMIIISHDRHFLNQVCTHMADMDYGTLKVYPGNYDDYMLASTQAR
ERQQAANAKAKERVADLQDFVRRFSANKSKARQATSRLKMIDKIKIEEFKPSSRQNPFIR
FEYEKKLHNIAVVADSITKKYDRTIFNNFNLSVQPGERIAIIGENGAGKTTLLRSLLGNL
ALEHGSVKWAENANVGYMPQDTYEEFPGDVTLMDWIDQYRKEGDDEQMVRGTLGRLLFNA
DDIRKSVKVLSGGEKGRMIWGKLMLGRHNVLLMDEPTNHMDMESIESLQIALDKYDGTLI
FVSHDREFVSGLAHRIIEVKTDGTLNDFGGNYEDFLSSQGLQ