Protein Info for QEN71_RS06750 in Paraburkholderia sabiae LMG 24235

Annotation: type IV secretory system conjugative DNA transfer family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 PF02534: T4SS-DNA_transf" amino acids 15 to 447 (433 residues), 356.7 bits, see alignment E=3.3e-110 PF10412: TrwB_AAD_bind" amino acids 191 to 430 (240 residues), 56.1 bits, see alignment E=4.6e-19 PF12696: TraG-D_C" amino acids 295 to 415 (121 residues), 90.8 bits, see alignment E=1e-29

Best Hits

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 95% identity to bpy:Bphyt_6495)

Predicted SEED Role

"Type IV secretion system protein VirD4" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>QEN71_RS06750 type IV secretory system conjugative DNA transfer family protein (Paraburkholderia sabiae LMG 24235)
MNARTLIDASPIVVGIWRGRYLRFSGQQFVLLAAPARSGKGVSIVIPNLLSYPDSVVVLD
IKRENYAITAGFRRAQGQEVYLFDPFAEDGRTHRFNPLSAISDGLFRVGDILAIGYALYP
PGGHDDFWKDQARNLFLGIVLLLSEWRDARRTGRGESIPDYPVTMGEVLRQSSGHGMPVK
AYLQRALVQHRALLSGACVDALNRFLSNDDKVLASILATFHAPLTIWANPIVDAATSAND
FDLRDVRRRRMSIYIGITPDHLSEAALLVNLVFSQLVNLNTKQLPETDPTLRFQCLLLLD
EMTAIGKIHIIARAVAYMAGYNLRLLSVVQSIAQLESVYGRADARTFLTNHAMQILYAPR
EQKDANDYSEMLGTFTDQSRSVSRPNTMFGGRGGSSESMSEQRRPLLLPQELKELGRDKE
IIVLENTKPILADRICYWRDPVFASRVLIAPSVPAMDLARFTAQIERRVRAVESDEIDPE
GAGLLHLSPEYLEVLQAWDPRDLPPRLADLSEDEVTAYVDRHFMLLGVPARHIGQATRRL
SIADLDVAELVPPTSARERRGPVTRAGTNTASIEGAWR