Protein Info for QEN71_RS06725 in Paraburkholderia sabiae LMG 24235

Annotation: type IV secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details PF04335: VirB8" amino acids 12 to 220 (209 residues), 182.5 bits, see alignment E=5.1e-58

Best Hits

KEGG orthology group: K03203, type IV secretion system protein VirB8 (inferred from 98% identity to bpy:Bphyt_6500)

Predicted SEED Role

"Inner membrane protein forms channel for type IV secretion of T-DNA complex (VirB8)" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>QEN71_RS06725 type IV secretion system protein (Paraburkholderia sabiae LMG 24235)
MSTDDDYGRVLDIEASLTHLREQSERRAWHVAYGAVGVAVLSVMALAVMVPFYRVVPLPI
EVDRLTGESQVIDVLDARHVHTREIQDKHWVEAYVRERERYDWGLLQMDYDSVLAMSDDV
VARDYRGIYSGPDALDRQLGPNTERRVRILSTTLPPDEPGHAVVHIERTTFKNGQANAEP
TQRFVITLAYAYRPPVFTRESVAVTNPFGFKVTAYSRDPEYTPPASSSSAGGAP