Protein Info for QEN71_RS06715 in Paraburkholderia sabiae LMG 24235

Annotation: type IV secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 163 to 189 (27 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details PF04610: TrbL" amino acids 39 to 273 (235 residues), 101 bits, see alignment E=4.5e-33

Best Hits

KEGG orthology group: K03201, type IV secretion system protein VirB6 (inferred from 95% identity to bpy:Bphyt_6503)

Predicted SEED Role

"Integral inner membrane protein of type IV secretion complex (VirB6)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>QEN71_RS06715 type IV secretion system protein (Paraburkholderia sabiae LMG 24235)
MSGLFTAIGGTLENGMSTYVTNVSSALSAALVPVVTTAVTIWVIAYGLAIVRGEAHEAVP
AFAWRGLKVAAILAFALGSGIYQQQVVMAVSGATSGLAQTIQNAANTTGGGNPGCGSVSG
SSVTSTGATGIYQTLDCYDQQIDLVLDAYSEKATHEGLSPSGLAAAIGDIVCGFIAAVGG
SIFLIVLAFEVVMGRMLLDLVLGIGPIFIACAAIAPTARFFEAWTAKVANYALLQVLVAA
FLGMALTAFSTELAPFQVTTSAPGTNAAALVAASQAALEAASAWGAALGMFATAIFLAMV
GWQLPSVASGLSGGATVSGFGAFIAGVASRRLATVIGQMLTRSGNGPRPGGTIRDRTGSG
GGSGNSSGGVAPAYQRAAHANLGQGS