Protein Info for QEN71_RS06445 in Paraburkholderia sabiae LMG 24235

Annotation: CDP-archaeol synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01148: CTP_transf_1
  • amino acids 3 to 272 (270 residues), 201.6 bits, E=2.2e-63
• PF01864: CarS-like
  • amino acids 168 to 265 (98 residues), 22.8 bits, E=8.2e-09

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 98% identity to bph:Bphy_1333)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Protein Sequence (273 amino acids)

>QEN71_RS06445 CDP-archaeol synthase (Paraburkholderia sabiae LMG 24235)
MLKTRVITAIVLLAILIPVTLWAPIGGFGALIAFVVVFAAWEWARLLKLPGAGPVIYAII
AALALVASTKLGTGVTAPRPLFQASSIFWIFAGPFVLLRKPTLAQGAWRPFLLLAGVVVF
AACWHALVAARMAGVPFVLSLLLVVWLADIGAYFAGKAFGKHKLAPSISPGKTWEGAIGG
WLAVMIVAAVAVATHAFAPTLFSALLDHLGTARAFATLTLLVVFSVVGDLFESMLKRQAG
VKDSSNLLPGHGGVLDRIDALLPVLPLAMLVLS