Protein Info for QEN71_RS06145 in Paraburkholderia sabiae LMG 24235

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 29 to 213 (185 residues), 167.5 bits, see alignment E=3.1e-53 PF01171: ATP_bind_3" amino acids 30 to 209 (180 residues), 180.8 bits, see alignment E=3.5e-57 PF09179: TilS" amino acids 259 to 326 (68 residues), 47.5 bits, see alignment E=2.7e-16 PF11734: TilS_C" amino acids 391 to 453 (63 residues), 71.5 bits, see alignment E=4.6e-24 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 391 to 434 (44 residues), 40.1 bits, see alignment 1.9e-14

Best Hits

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 88% identity to bph:Bphy_1387)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>QEN71_RS06145 tRNA lysidine(34) synthetase TilS (Paraburkholderia sabiae LMG 24235)
MTSSADTSADRLVLDAVGVVFGALPNDARVAIAFSGGVDSTVLLDAAVRIGGASRCIAFH
VHHGLSSNADEWLAHCAAFARERNVEFASVHVDVSRAAGVSIEAAARDARYRALDALCKQ
HDVHTLWLAQHADDQAETVLLQLLRGAGLAGLAAMAPEYLPSGASVTRARPLLHLLRAQL
EQYAHARDLRWIDDESNADTRYARNALRHDVLPGLAVHFPGFRDALARTAAHAAAAQRLL
DELARVDLQTAYGEEEGALSRDALLALDDDRAANLLRYWMRTLGLPAASTARLTDALRQL
REIGDAHTLRVDHAGQALRSYRGQIYWEAGDSADPADETALVERAESVLAWKGESVWRLP
QWRGTFVFADASADASDAIPADALTRVPLIARSRSGGERMRCASNGPSRTLKNLFQERGV
PSWKRDVPLLFAGDVLLFVPLIGVNRAAIDDPSQVKNARYIRIEWREDLTLA