Protein Info for QEN71_RS06015 in Paraburkholderia sabiae LMG 24235

Annotation: protease modulator HflC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01145: Band_7
  • amino acids 24 to 199 (176 residues), 104.9 bits, E=2.6e-34
• TIGR01932: HflC protein
  • amino acids 103 to 282 (180 residues), 141.6 bits, E=1.3e-45

Best Hits

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 89% identity to bph:Bphy_1412)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (306 amino acids)

>QEN71_RS06015 protease modulator HflC (Paraburkholderia sabiae LMG 24235)
MNKIVALVVAIVIVLFAASSMVFVVDQRHMAVVSARGDAAPTLAGPGLHVKLPPPLQTVT
SVDTRIQSLDTPDEDRYATSDKTELLVNPVVKFRVSDPVKLVSETKGDVQSLTDRLALLA
RGALGDAFAKYTLSDALSKQDAIATQARDGMQKGAASLGVDVVDVTLTRIDFPAAMADSV
FKRMIAAREQIANQERSEGASEADKIKADAAQQQQAVLADAYKQAQAIKGDGDGKAASIA
ADAYGRDPQFYQFYQSMQAYKNSFKPGDVMVVDSSSEFFRFMRGPDGGGAAQSQSSPAAS
TGAHKH