Protein Info for QEN71_RS05735 in Paraburkholderia sabiae LMG 24235

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 5 to 75 (71 residues), 72.1 bits, E=1.4e-23
  • amino acids 108 to 178 (71 residues), 78.4 bits, E=1.5e-25
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 220 to 671 (452 residues), 480 bits, E=3.7e-148
• PF07992: Pyr_redox_2
  • amino acids 221 to 541 (321 residues), 207.9 bits, E=1.1e-64
• PF12831: FAD_oxidored
  • amino acids 221 to 258 (38 residues), 32.5 bits, 3.1e-11
• PF01134: GIDA
  • amino acids 221 to 286 (66 residues), 29.7 bits, E=1.8e-10
• PF00070: Pyr_redox
  • amino acids 389 to 465 (77 residues), 47.2 bits, E=1.3e-15
• PF02852: Pyr_redox_dim
  • amino acids 560 to 668 (109 residues), 116.2 bits, E=4.2e-37

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 87% identity to bmu:Bmul_1135)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (685 amino acids)

>QEN71_RS05735 dihydrolipoyl dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSLVEVKVPDIGDFKDVDVIEVNIKPGDTIEKEQSLLTLESDKASMEVPSDTAGTVKEVR
IKAGEKVSQGTVIAVVETSGDAKAAKEPEKAAPAPAAAPAASGGGVQEIKVPDIGDYKDV
PVIEVAVKVGDRVEKEQSLVTLESDKATMDVPSPAAGVVKELKVKVGDNVSEGSVLLLLE
GEGAAAAPAPKAAAPAPSPAAAPAPAPQAGSYSGSVDVECDMLVLGAGPGGYSAAFRSAD
LGMKTVLVERYSTLGGVCLNVGCIPSKALLHTALVIDEAEALGSHGITFGKPQIDLDKLR
DFKSGVVKKLTGGLAGMAKARKVEVVTGVGSFVDPYHMEVQGENGKKVVRFKQAIIAAGS
QAVKLPFIPEDPRVVDSTGALELRQIPKRMLVIGGGIIGLEMATVYATLGAEIDVVEMLD
GLMTGADRDLVKVWEKFNSKRFGNVMLKTRTTGAEAKPDGIYVTFEGEKAPAEPQRYDLV
LVAVGRSPNGKKIGADKAGVAVTDRGFIDVDKQMRTNVPHIFAIGDVVGQPMLAHKAVHE
GHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKTEDQCKAEGIKYGKAVFPWAASGRA
IANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAIEMGADATDIGKTIHPHPT
LGESIGMAAELYEGVCTDLPPQKKK