Protein Info for QEN71_RS05460 in Paraburkholderia sabiae LMG 24235

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details PF00892: EamA" amino acids 9 to 140 (132 residues), 65.6 bits, see alignment E=2.8e-22 amino acids 161 to 291 (131 residues), 69.4 bits, see alignment E=1.8e-23

Best Hits

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_1522)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>QEN71_RS05460 DMT family transporter (Paraburkholderia sabiae LMG 24235)
MNPVNVFQLLILAALWGASFLFIRVGVGDFGVAPLMALRVGIGALFLLIVLVARRPLRES
AATLRTRALPLLVVGILNSAAPFCLFAYAEITLSAGVTSVINATTPLWGALVAFVWLKDR
LSALRSVGLVIGFAGVLMLVWDQIAAPSGTNVSPTTTALAAAAALGATLLYGIAASYTKK
HLTGVDALTVATGTMIGATIVLLPLAVASWPAAAPSMKAWGSVIALGVACTGIAYMLFFH
LIAVAGPARAITVTFVIPIFGILWGALFLGERVSLGMIEGCAVILVGTALATGVVKRIPG
FGGRRVSERC