Protein Info for QEN71_RS05390 in Paraburkholderia sabiae LMG 24235

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14691: Fer4_20
  • amino acids 22 to 129 (108 residues), 124.6 bits, E=8.4e-40
• PF07992: Pyr_redox_2
  • amino acids 143 to 430 (288 residues), 135.1 bits, E=1.7e-42
• PF00890: FAD_binding_2
  • amino acids 144 to 175 (32 residues), 23.1 bits, see alignment (E = 2.1e-08)
• PF13450: NAD_binding_8
  • amino acids 146 to 178 (33 residues), 33.8 bits, see alignment (E = 1.7e-11)
• PF01593: Amino_oxidase
  • amino acids 152 to 178 (27 residues), 23.6 bits, see alignment (E = 1.5e-08)
• PF00070: Pyr_redox
  • amino acids 277 to 352 (76 residues), 32.7 bits, E=4.5e-11

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 92% identity to bph:Bphy_1535)

Predicted SEED Role

"Pyridine nucleotide-disulphide oxidoreductase associated with reductive pyrimidine catabolism" in subsystem Pyrimidine utilization

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Protein Sequence (449 amino acids)

>QEN71_RS05390 NAD(P)-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MAIKQTGDIAAHRLSSDQLSCEFADIAPLLDPTAAAAAASRCHYCYDAPCVQACPTQIDI
PSFIRKIGNGNLKGAATDILSANPLGGMCARVCPTEILCEGACVRNHQDAKPVAIGALQR
HATDWAMAHDAVQFARAADSGRHVAVVGAGPAGLACAHRLAVAGHRVTIYDARDKGGGLN
EYGIAAYKTVDDFAQREVQWLLSVGGIELKTGVALSRDVTLDSLRQQHDAVFLAIGLTGV
RALELEGAALSGVMNAVDFIEQVREATDLSTVPVGRRVVVIGGGNTAVDAAVQSRKLGAT
NVTMVYRRGVESMSATWAEREFAQTQGVTLITHAKPVRLMGSDGIVTGVEFERTARDGSA
ERFTVEADMVLKAIGQTLVATGLEHALLTLDQHRIAVDADMRTSLDNVWAGGDCAASGGI
DLTVQAVQDGKLAAASIDAAFALAAVKAA