Protein Info for QEN71_RS05085 in Paraburkholderia sabiae LMG 24235

Annotation: inositol 2-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR04380: inositol 2-dehydrogenase" amino acids 9 to 334 (326 residues), 419 bits, see alignment E=5.4e-130 PF01408: GFO_IDH_MocA" amino acids 10 to 126 (117 residues), 80 bits, see alignment E=3.6e-26 PF22725: GFO_IDH_MocA_C3" amino acids 134 to 254 (121 residues), 83 bits, see alignment E=2.7e-27 PF02894: GFO_IDH_MocA_C" amino acids 138 to 335 (198 residues), 95.4 bits, see alignment E=7e-31

Best Hits

Swiss-Prot: 42% identical to YRBE_BACSU: Uncharacterized oxidoreductase YrbE (yrbE) from Bacillus subtilis (strain 168)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 96% identity to bph:Bphy_1595)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>QEN71_RS05085 inositol 2-dehydrogenase (Paraburkholderia sabiae LMG 24235)
MTEVAGKTIDVAVFGAGRIGKIHASNLARQPGVRLKYVVDVNREAAAALAAQYGAQVADI
DGAMGDASVGATVICSSTDTHADLILQSAAQKKHVFCEKPVDLTLERARACADAVAKAGV
VCMIGFQRRFDPTFAALKARIDAGEIGTPEMLVVTSRDPGAPPVEYIKHSGGIFKDMLIH
DFDIFRWILDDDAETVHATGSCLSDPAIAEAGDIGSTAVTIRTKRGRLCQINTARRAAYG
YDQRFEVLGSEGMLQAGNVRPTEVTAYSKSAVSSDVPEHFFLERYRAAYALEIAHFFEAV
TQGKPVRTTVADGMKALELAEAATRSWREGRAVKLNEAL