Protein Info for QEN71_RS04760 in Paraburkholderia sabiae LMG 24235

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03413: hydroxyacylglutathione hydrolase
  • amino acids 7 to 266 (260 residues), 323.7 bits, E=3.5e-101
• PF00753: Lactamase_B
  • amino acids 15 to 178 (164 residues), 56.9 bits, E=4.4e-19
• PF12706: Lactamase_B_2
  • amino acids 42 to 92 (51 residues), 28.9 bits, 1.3e-10
• PF16123: HAGH_C
  • amino acids 179 to 266 (88 residues), 92.4 bits, E=2.8e-30

Best Hits

Swiss-Prot: 62% identical to GLO2_CUPTR: Hydroxyacylglutathione hydrolase (gloB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 91% identity to bph:Bphy_0870)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Protein Sequence (267 amino acids)

>QEN71_RS04760 hydroxyacylglutathione hydrolase (Paraburkholderia sabiae LMG 24235)
MNSLEYVPVPAFDDNYIWVVSDGHHAVVVDPGDAAPVKAYLSERGWRLSAILLTHHHADH
VGGVADLLNGQDVPRDLPVYGPAGETIPWLTVRLQQGDTVHIAAPSLDFTILDVPGHTSG
HIAYFQAADLRGTPHVFCGDTLFACGCGRLFEGTPAQMLTSLDSLAALPGDTEVHCAHEY
TLSNIRFALACEPDNAKLQAWRDEATALRARQVPTLPTTIAHERAVNPFLRAGEASVQAA
LADQLHESVPDRLAAFTLMREWKNRFR